PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10029270
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family BES1
Protein Properties Length: 356aa    MW: 38404.5 Da    PI: 8.7728
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10029270genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822201.13.4e-6221451149
       DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpl.eeaeaa..gssasaspesslq 95 
                  ++++r+ptwkErEnnkrRERrRRaiaakiy+GLR++Gnyklpk++DnneVlkALc eAGw+ve+DGttyrkg++p  e+++++  g s+sasp+ss+q
  Lus10029270   2 TSGTRMPTWKERENNKRRERRRRAIAAKIYTGLRMYGNYKLPKHCDNNEVLKALCLEAGWIVEEDGTTYRKGCRPAvERMDIMggGGSTSASPCSSYQ 99 
                  5899*************************************************************************9999872257999******** PP

       DUF822  96 sslkssalaspvesysaspksssfpspssldsislasaasllpvlsvlslvsss 149
                          +sp++s+ +sp ss++  ++  +++++a+a+sl+p+l++ls++sss
  Lus10029270 100 --------PSPASSSFPSPISSHYTTNAVNNNNNAADANSLIPWLKNLSSSSSS 145
                  ........5555555555556666666666677777788999999999887665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056878.0E-593140IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MTSGTRMPTW KERENNKRRE RRRRAIAAKI YTGLRMYGNY KLPKHCDNNE VLKALCLEAG  60
WIVEEDGTTY RKGCRPAVER MDIMGGGGST SASPCSSYQP SPASSSFPSP ISSHYTTNAV  120
NNNNNAADAN SLIPWLKNLS SSSSSASSSK HNHPHNLYIH TGSISAPVTP PLSSPTAQSP  180
RRKKQNDVWG DDHHHPSACP SWVGQNYPFL PSSSMPSSTP QSPSRYPDPS AWLPGMQSGP  240
TSPTFSLVAR NPFGSGAGSR MWTPGQSGTC SPAVFDHTAD VPMADSSMAA EFAFGSNSSS  300
AAARLVKPWE GERIHEELIS DDLELTLGSS KTSAGDVATE RWNVDGWKKA RMSSE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009352718.11e-133PREDICTED: BES1/BZR1 homolog protein 4-like
SwissprotQ9ZV881e-105BEH4_ARATH; BES1/BZR1 homolog protein 4
TrEMBLV4W9571e-127V4W957_9R
TrEMBLA0A067GE961e-127A0A067GE96_CITSI; Uncharacterized protein
STRINGPOPTR_0004s06100.11e-119(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26613375
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78700.12e-76BES1/BZR1 homolog 4